SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714233|ref|YP_007062857.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714233|ref|YP_007062857.1|
Domain Number 1 Region: 28-250
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.22e-56
Family Class I glutamine amidotransferases (GAT) 0.0000054
Further Details:      
 
Domain Number 2 Region: 210-438
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.28e-56
Family N-type ATP pyrophosphatases 0.00000205
Further Details:      
 
Domain Number 3 Region: 424-544
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 8.5e-53
Family GMP synthetase C-terminal dimerisation domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714233|ref|YP_007062857.1|
Sequence length 544
Comment GMP synthase [Synechococcus sp. PCC 6312]
Sequence
MSQPTTTELTTTTPAPLDTSTMLEALNRQMIVILDFGSQYSELIARRIRETSVYSEVVSY
RTTAAQLRQIAPKGIILSGGPNSVYDDQAPACDPEIWELGIPVLGVCYGMQLMVKQLGGE
VERASRGEYGKASLLIDDPTDLLTNVENTATMWMSHGDSVTQLPGGFKTLAHTTNTPCAA
IADDQRQFYGVQFHPEVVHSIGGQALIRNFVYHICGCEPTWTTAAFVDEAIREVRAKVGD
KRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKYEPERLVKLFQEQFHIPVVY
VNARERFLAQVVGVTDPEEKRRRIGHEFIQVFEEESNRLGPFDYLAQGTLYPDVIESANT
NIDPKTGERVAVKIKSHHNVGGLPPNLRFKLVEPLRKLFKDEVREVGRSLGLPDEIVRRH
PFPGPGLAIRIIGEITPERLDILRDADLIVRQEINRSETYHDLWQAFAVLLPVRSVGVMG
DQRTYAYPIVLRLVSSEDGMTADWSRVPYELLETISNRIVNEVPGVNRVVYDITSKPPGT
IEWE
Download sequence
Identical sequences K9RYH0
gi|427714233|ref|YP_007062857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]