SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714240|ref|YP_007062864.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714240|ref|YP_007062864.1|
Domain Number 1 Region: 15-413
Classification Level Classification E-value
Superfamily Clc chloride channel 1.83e-64
Family Clc chloride channel 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427714240|ref|YP_007062864.1|
Sequence length 423
Comment chloride channel protein EriC [Synechococcus sp. PCC 6312]
Sequence
MTEQCKEPKALPYPKLLLYAAGVGLVGGFLATLFYLAMKLGFSLLWNELPGRAILPNWDQ
LRYRVWIITGIGGLLVGLIVKYLGAAGGLAGAVKELHKYGKLDYTKLPGTALASWLSLTV
GSSAGPESPLIDINGGVGSWIADRLKLSTRDARILTFCGMGAGMGVFFSAPLGAALFVLE
IPHRRGLEFFEAIIPTLMSAFMGFAVFRCATGVTFGGIYSFPPYEQLRPIDIGSAVLLGV
VGAGVGLLFLGIDIVVQRLVYPLRKRPLLLITLGGLAFGLIAMAFPITLFYGEAQIQEIL
DTGMRYSSWLLFLIAIMKMLALSLSLQSGFKGGVVFPVFFVGACVGMGVHQLIPGIPLSV
ALVCMMAAIGVSIVNAPMSMIMILSTISHTSITPLITTATLTSFILTQEFSIVPTQQCRQ
DLN
Download sequence
Identical sequences K9RXR4
gi|427714240|ref|YP_007062864.1| WP_015125861.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]