SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714322|ref|YP_007062946.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714322|ref|YP_007062946.1|
Domain Number 1 Region: 68-237
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.94e-37
Family MJ1460-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714322|ref|YP_007062946.1|
Sequence length 269
Comment putative hydrocarbon binding protein (contains V4R domain) [Synechococcus sp. PCC 6312]
Sequence
MIVISICATDEPANKPLNHTHRGTCCELMVVSQNTVAHLTSRNMLQPLATQTLRERHPQR
RNHFSVEDHFHFNREQGTIHDWHQARNILVTEDFIVGMITGLEQEVGPASTLVMYKIGEE
WGLKDADFFQRNFRQEYNRELRQTNLSFLFEAWWWPFVTQGWGNWDIDLSEQKNGFMFIN
IFDSVVARTLGDVGKPVCYLYAGMFAGFFTGLIKKSLGCIEIQCYAMGETYCKFLVGKQE
RIDAASFWQNEGASASDIEKRMKNGQLSP
Download sequence
Identical sequences K9RY80
gi|427714322|ref|YP_007062946.1| WP_015125940.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]