SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714357|ref|YP_007062981.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714357|ref|YP_007062981.1|
Domain Number 1 Region: 142-360
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.58e-52
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000772
Further Details:      
 
Domain Number 2 Region: 446-586
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000825
Further Details:      
 
Domain Number 3 Region: 11-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.13e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0049
Further Details:      
 
Domain Number 4 Region: 362-438
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|427714357|ref|YP_007062981.1|
Domain Number - Region: 593-636
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0256
Family CopG-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427714357|ref|YP_007062981.1|
Sequence length 637
Comment sulfite reductase (ferredoxin) [Synechococcus sp. PCC 6312]
Sequence
MAPSPLTDLKPYKPSKVETLKERSNHLREPVASELLQDTTHFSEDAIQILKFHGSYQQDN
RDNRVKGQEKDYSFMLRTRSPAGYIPPQLYLTLDRLADEYGNSTIRATTRQGFQLHGILK
RNLKATIAAIVKSMGSTLGACGDLNRNVMAPPAPFTNRPEYQLAYDYAHRIADLLTPQTG
AYYEIWLDGEKVISAEEAPEVKAARQRNGNGTLMHDDEEPIYGTQYMPRKFKVAVTVPGD
NSIDLFSQDLTLVVITDARGKLKGFNIYAGGGLGRTHNKEETFARAADPIGYVDGADVYD
VVKAIVATQRDYGDRQTRRHARLKYLIHDWGVAKFKAKVEEYFAKPLQPLYELPPFQYED
FLGWQEQGDGRYFYGLSIANGRIWDRQGFRLKTALQKIVTHYDLPMRVTPHQNVILSDIE
PQDRVAIQALLDDHGISRLETIDPLERYAMACPALPTCGLAITESERAIPTVLERIRVVM
DRVGLKQEHFVIRMTGCPNGCARPYLAELGFVGITPETYQLWLAGCPNQTRLAQTFIEKL
PIAELEVTIEPLLVFYKKSRLTKPGLESFGDFCHRVGFEALREFMATYQPLSHKGRRYRV
DVRDDQYQQLKDLASQDNKSIAAVTREAIAAYLSHHA
Download sequence
Identical sequences K9RYB1
WP_015125975.1.5248 gi|427714357|ref|YP_007062981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]