SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714439|ref|YP_007063063.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714439|ref|YP_007063063.1|
Domain Number 1 Region: 294-466
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.27e-71
Family Transhydrogenase domain III (dIII) 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427714439|ref|YP_007063063.1|
Sequence length 467
Comment NAD/NADP transhydrogenase subunit beta [Synechococcus sp. PCC 6312]
Sequence
MGNWLISIQELSYLAAAALFIVGLKQLGSPATARNGNRLAAVGMLVAVIVTLIDRQVVSF
EMILLAMALGSAIGVVLAYKVAMTDMPQMVGILNGLGGAASALVAMGEFWRLVTTGETLT
TSSLVTILLGVLIGGITLTGSLVAFAKLQGIIPGSPVRFPLQQAVNAFLVIAFLAGSAYL
FVDPNQLPLFWGLTAVASVIGVLMVIPIGGADMPVVVSLLNSLSGVAASAAGFVVGNSML
IIAGALVGASGLILTQIMCKAMNRSLLNVLFSGFGSGPATVAGETGATTQQPVRTLEAEE
GAMMLGYAKSVVIIPGYGMAVAQAQHSVKELADQLERLGVDVKYAIHPVAGRMPGHMNVL
LAEANVPYPQLRDMDDINPEFEHVDVALVIGANDVVNPAARSNPGSPIYGMPILDVDRAH
HTIVIKRSMNAGFAGIENDLFYKDKTMMMFGSAKEVLTQLVTEVKQL
Download sequence
Identical sequences K9RX12
gi|427714439|ref|YP_007063063.1| WP_015126057.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]