SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714528|ref|YP_007063152.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714528|ref|YP_007063152.1|
Domain Number 1 Region: 527-952
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-139
Family DNA polymerase I 0.0000000128
Further Details:      
 
Domain Number 2 Region: 6-154
Classification Level Classification E-value
Superfamily PIN domain-like 1.49e-44
Family 5' to 3' exonuclease catalytic domain 0.0000528
Further Details:      
 
Domain Number 3 Region: 341-525
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.36e-42
Family DnaQ-like 3'-5' exonuclease 0.00018
Further Details:      
 
Domain Number 4 Region: 185-294
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.18e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714528|ref|YP_007063152.1|
Sequence length 953
Comment DNA polymerase I family protein [Synechococcus sp. PCC 6312]
Sequence
MTRPNSTLLLVDGHSLAFRSYYAFAKGRDGGLRTSTGIPTSITFGFLKTLLEVIQAEQTD
HLAVAFDLGGPTFRHEADSTYKEGRPETPDDFAPDLENLQLLLQALSVPILISPGYEADD
VIGTIAQQASQAGLKVKIVSGDQDLFQLIDPEKGISVLHLSSAFAKSTTAAKEFGPEEVK
SKLGVWPRQVVDYKALCGDTSDNIPGVRGIGPKTAVQLIEQFETLDNIYAHLDQIKGATQ
KKLKEGLESARHSQFMAQIALNVPIEVSLEQLVLGDFDWHTLDPLLAKLEFKAIKTSLLQ
LHTQLGGAQLAAETLSQDEDWFFSANDTENAQPPHLDVQIINSPAKLDQLIETLKQQTDP
NKPVAWDTETTSLSPRDAQLVGIGCCWGPGLDQMAYLPLGHRTGQNLELSVTLEKLQPIL
RDPNYPKVLQNAKYDRLVLQFQGLELTGVVFDPMLASYVINPEGSHNLTDISSRYLPIRA
LTYGELVSKGQSLADVSISEVAQYCGLDVYTTYLLVDPLRQELSQTPKLLELLEQVELPL
EPVLAAMETVGIRIDVDYLKQLSEQLNHQLNQLETQAYELAGFDFNLGSPKQLSQLLFHT
LGLDIKKTRKTKLGYSTDAATLEKLQGDHPIIDLILEHRTLAKLKSTYVDALPELVRPDT
QRVHTDFNQAITATGRLSSSNPNLQNIPIRTEFSRQIRAAFIPEPDWILISADYSQIELR
ILAHLSQEPRLITAYQNRQDVHTLTAQLLLDKTEINSEERRLAKIINFGVIYGMGAQRFS
REAGVNLANAKEFIAKFYDRYPQVFTYLQRMEYQAISQGYVQTILGRRRYFNFDSSDLTQ
LKGKPIQELEKIDINKLKMTNFERGQLRAAANAPIQGSSADLIKVAMVKLQQALQPYQAQ
ILLQVHDELVMEMPQEEWQALQPLIETTMAQAIPLSVPLVVEAHPGPNWMSTK
Download sequence
Identical sequences K9RZ96
gi|427714528|ref|YP_007063152.1| WP_015126146.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]