SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714595|ref|YP_007063219.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714595|ref|YP_007063219.1|
Domain Number 1 Region: 113-281
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.96e-57
Family NadC C-terminal domain-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 5-112
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.41e-26
Family NadC N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714595|ref|YP_007063219.1|
Sequence length 287
Comment nicotinate-nucleotide pyrophosphorylase [Synechococcus sp. PCC 6312]
Sequence
MAILPHWLILDTLLQAWLQEDIGRGDRTTQALGLGEQTGQAELEIKQAGMIAGLSIFGRV
FQLLQPTAQIELLIQDGEPANPSQIAARVTASLETLLLGERVALNLVMHLSGVASLTRIY
ADLIADLPTQLVDTRKTTPGLRLLEKYATQVGGAINHRLGLDDAVMIKDNHIQAAGGIAQ
ALDQIRTQIPFTHKIEVETETLGQVQTALAAGADIIMLDNMPIERMTQAVDMIRHQRPEV
KIEASGNITQETIRTVALTGVDYISTSATITRSPWLDCSLNLLAEMK
Download sequence
Identical sequences K9RYS5
WP_015126213.1.5248 gi|427714595|ref|YP_007063219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]