SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427714670|ref|YP_007063294.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714670|ref|YP_007063294.1|
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.09e-27
Family Thioltransferase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714670|ref|YP_007063294.1|
Sequence length 89
Comment glutaredoxin, GrxC family [Synechococcus sp. PCC 6312]
Sequence
MSQAKVEIYTWATCPFCIRAKQLLSRKEVQFTEYGIDGDETARAAMAKRANGKRSLPQIF
INDQHVGGCDDLHRLEAQGKLDILLQSGV
Download sequence
Identical sequences K9RZ05
WP_015126288.1.5248 gi|427714670|ref|YP_007063294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]