SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712073|ref|YP_007060697.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712073|ref|YP_007060697.1|
Domain Number 1 Region: 124-318,416-564
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.69e-105
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000118
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 8.99e-34
Family GAD domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.76e-32
Family Anticodon-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712073|ref|YP_007060697.1|
Sequence length 596
Comment aspartyl-tRNA synthetase [Synechococcus sp. PCC 6312]
Sequence
MRTHYCADLRLSHVDKTVTLFGWVDRRRDHGGVIFLDLRDRTGLVQIVSDPQRTPESYPQ
ADKLRSEYVVKIVGRVSQRPADSLNPKLPTGEIEIYAETIELLNPVRKQLPFQVSTAEHE
SVREELRLRYRYLDLRRERMAQNLQLRHQVVKAIRRYLEDQEQFLEVETPLLTRSTPEGA
RDYLVPSRVNPGEWFALPQSPQLFKQLLMVSGCDRYYQIARCFRDEDLRADRQPEFTQLD
MEMSFLDQEEILALNEGLVCHIFETIKGLKLPRPFPRLTYAEALDRYGTDKPDTRFGLEL
VDVSDILKDSGFKVFSQAVASGGIVKILPIPGGNEQISNVRIKPGGDLFQEATTAGAKGL
AYIRVRENGDIDTIGAIKDNLSPEQKTELLARTGATSGHLLLFGAGETNTVNKTLDRLRQ
VVGKEFGLIDANRNNLLWVVDFPMFEWNPTEKRLEALHHPFTAPRPEDIKDLKTAKAQAY
DLVLNGFEIGGGSVRIYQSDLQEQVFETIGLTPEEAHDKFGFLLEAFEYGTPPHGGIAYG
LDRLVMLLAGEDSIRDAIAFPKTQQARCLLTGAPANVASQQLKELHVTSTHRPKPN
Download sequence
Identical sequences K9RS90
gi|427712073|ref|YP_007060697.1| WP_015123698.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]