SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspbr1|57614|fgenesh1_pm.11_#_243 from Aspergillus brasiliensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspbr1|57614|fgenesh1_pm.11_#_243
Domain Number 1 Region: 123-486
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.37e-97
Family Glutamine synthetase catalytic domain 0.000039
Further Details:      
 
Domain Number 2 Region: 23-117
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000000628
Family Glutamine synthetase, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspbr1|57614|fgenesh1_pm.11_#_243
Sequence length 488
Sequence
MSSATPPYEVTLENVAHVLQNDTRVKLAGVDVDGMLRGKLVSKKKFLSIVADGFGFCSVI
FGWDMHDRTYFKELAISNKENGYRDLVAVPDLSSFRRIPWENNVPFFLVSFLDPDTKEPV
CACPRGLLKSALGKAEAAGYRAMAGAEYEFYQFRVPETHSNPERNASATATFLKENPVES
LPSLTEGMFGYSLTRPIHNQDYYYGVFDACEQFNCEIEGWHTESGPGVYEAALQFGEAKE
MADKAGLFKYVVKSIGTKHGITPTFMAKPREGLPGNSGHMHISLVSSDGKNAFIRDTPDP
NPPYPDVAYLSDLGRHFLAGVLTGLPDIMPMFAPTVNSYKRLVENFWAPVTVSWGLEHRA
ASIRLITPPTASAKATRLEVRVPGADANPHFVLAAVVALGWRGVEKKLEIPVPPLSKGED
MGGASDKGVRLAKSLREATTAFMRKDSVAREVFGDAFVEHFGGTREHEVRLWEEAVTDWE
VRRYIETV
Download sequence
Identical sequences A0A1L9UBS7
jgi|Aspbr1|57614|fgenesh1_pm.11_#_243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]