SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspbr1|169859|estExt_Genewise1Plus.C_2_t40274 from Aspergillus brasiliensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspbr1|169859|estExt_Genewise1Plus.C_2_t40274
Domain Number 1 Region: 34-379
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.28e-65
Family TK-like PP module 0.036
Further Details:      
 
Domain Number 2 Region: 403-604
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.37e-22
Family TK-like Pyr module 0.027
Further Details:      
 
Domain Number 3 Region: 609-753
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000471
Family Transketolase C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspbr1|169859|estExt_Genewise1Plus.C_2_t40274
Sequence length 806
Sequence
MPGEVIDRPNPKAEPSHIPDLVNQLQVQLQETRLEETDYNALLKFRRAAAYLAAAMIFLQ
DNVLLKQNLKHEDIKPRLLGHWGTCPGLILVYSHLNYIIRKHNLDMLYVVGPGHGAPAIL
ASLWLEGSLEKFYPQYSRDMDGLHELISTFSTSAGLPSHINAETPGAIHEGGELGYALAV
SFGAVMDNPDMIVTCVVGDGEAETGPTATSWHAIKYIDPAESGAVLPILHVNGFKISERT
IYGCMDNKELVSLFTGYGYQVRIVENLDDIDADLHSSIMWAVGEIHKIQKAARSGKPIMK
PRWPMIVLRTPKGWSGPKELHGSFIEGSFHSHQVPLPNAKKDKEELQALQKWLSSYNPHE
LFTETGDIIDEIKSVIPLDDSKKLGQRAEAYKGYRAPDLPDWQKFGVEKGTQQSAMKTIG
KFIDQVFTQNPHGVRIFSPDELESNKLDAALAHTGRNFQWDQFSNAKGGRVIEVLSEHLC
QGFMQGYTLTGRVGIFPSYESFLGIIHTMMVQYAKFNKMAQETTWHKPVSSINYIETSTW
ARQEHNGFSHQNPSFIGAVLRLKPTAARVYLPPDANTFLTTLHHCLKSKNYVNLMVGSKQ
PTPVYLSPEEAESHCRAGASIWRFCSTDNGLDPDVVLVGIGVEVMFEVIYAAAILRKRCP
ELRVRVVNVTDLMILEKEGLHPHALSTEAFDSLFGTDRPIHFNYHGYPGELKGLLFGRPR
LDRVTVEGYMEEGSTTTPFDMMLLNRVSRYHVAQAAVIGASRRNEKVQVRQHELVSEFGH
NIVETRKYILANRKDPDDTYEMPSFE
Download sequence
Identical sequences A0A1L9UX12
jgi|Aspbr1|169859|estExt_Genewise1Plus.C_2_t40274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]