SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|126207|fgenesh2_pm.C_scaffold_11000062 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|126207|fgenesh2_pm.C_scaffold_11000062
Domain Number 1 Region: 25-227
Classification Level Classification E-value
Superfamily ITPase-like 3.53e-35
Family Maf-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|126207|fgenesh2_pm.C_scaffold_11000062
Sequence length 240
Sequence
MAPKREPAVLPHALRVPGLTKLTGKRVVLASASPRRREILRTFGLAPEVVPSTFEEDLDP
MSFEDVHEYPVATATHKAVEVYERLVEENPDDAPDLVIGADTVVLTHAQAALSDAPFISA
QGARPEVLEKPAGRADNLRMLLDMNGAVLFPVLTAPGYAIRSIEERSLVYFADNPTYLLE
AYADSGEGADRAGGFAVQGLGGLLIRKVDGDFQNVVGFPAASFFRFLDLLVEEDDEFLEV
Download sequence
Identical sequences W4KA72
XP_009545061.1.39223 jgi|Hetan1|126207|fgenesh2_pm.C_scaffold_11000062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]