SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|103712|Genemark.4785_g from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|103712|Genemark.4785_g
Domain Number 1 Region: 185-666
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.97e-119
Family Pyridoxal-dependent decarboxylase 0.0000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|103712|Genemark.4785_g
Sequence length 679
Sequence
MSFLETKPTNGSYDQNLLASAPVATREEKQEGYNLDLLEEGRPRASASPPSEPSPASEHG
ATLANAAPIAAHSPARAAYKTPWYRTKAGVAGLIILTLVIIGAIIGGAVGGTRHKHHSTS
DSSPTTSSVSSSTSANGGLGQGAGGTGIGQGVATTTAPSTSQGVAGIGLVVAPTTVAAAA
LGVSFRKAGYQAIDRICDYYYSLREKPVAAQVEPGYLRKALPETAPNEGEVWQDIADDYQ
RLIIPGLTHWQHPSFFAYFPTACTFEGMLGDLYASSATNPGFNWFASPACTELESVVMDW
AAKMFGLDSSFHNISEVGGGVIQTTASDSALTAIVAAREQYHGLYPDVPLESLLIYVTTH
THSFGKKAGRVLGLRVRALDVDAAVRTGWGLDSDVLRTCVEEDRKAGLHPFIVIATVGTT
NSGAIDRIADIGATIEKDYPSIWLHVDAAWAGVTLSCPELRDRAQIKGINKYATSLCVNF
HKWGLTNFDTSALWVRDRKRLTDALDVTPEYLRTKHGDAGTVIDYRNWHLSLGRRFRSLK
LWFVLRSYGIEGFQAYIRKCIKMNDLFAEYVRTSNTFELVTPPSFALTVFRLVPPATASA
AWTPNELNSLNRRFHNALQEHHDQLLLTQTELVGVFCMRFAVGAARTNEEDIHRAWEVIK
KTGEDVLKQSTEDRNRVAE
Download sequence
Identical sequences jgi|Hetan1|103712|Genemark.4785_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]