SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|153628|estExt_fgenesh2_pm.C_10199 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|153628|estExt_fgenesh2_pm.C_10199
Domain Number 1 Region: 166-312
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000314
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number 2 Region: 328-509
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0098
Further Details:      
 
Weak hits

Sequence:  jgi|Hetan1|153628|estExt_fgenesh2_pm.C_10199
Domain Number - Region: 486-583
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.000235
Family PspA lactotransferrin-binding region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|153628|estExt_fgenesh2_pm.C_10199
Sequence length 831
Sequence
MSEDDRATKSARAKALLKKRQQKKGGAAAASSTPTPGSPLVRAYSPALSDTPADEDQGEL
ADVFARGAAPANSADVPWLASLERVGSPSVPPAPSPSSSPVRAAQQPMPSHSAQSPPPAP
SSLHPPAASSPPAEDETNSLHAVIQTQQQTISLLVSEKASLGASVERLSEVESRLRKAEQ
ALQLERDAGRAFEARVTQLEQDAHQASARIEELSARERTLEDTFREQERELQLTKGAADE
FQAEAERSLRRVRELEEQIQSDDRVERLEASLQNVQDHASELEFQMSKLKQAHAALKSER
DALESQLQARTASEADWAQRHADLAQQHAEHDSLARDHADLAARLEARQQSLSDLQAAAS
QAAAEHAATARQLQVAQGDLRAAVRRADEAERQQKALQAEGTALMGALEEMRPKIVELTD
AKLELTERAAGLERALRDRDSVVGHVEVALGAARDEKDAAEARLREAEARHEAERAAAQE
GMGELQRAYGELQAELDVASAGVRELETDRAAQRQLVSRQSGEIDRLQGAVHELKDVVAS
LRVELDERRTAASEQKEFLERARNEVEALRADLASRDDELEQLRATVEEAQTAAAAAAAS
AAEDDDSARSPMSPALDREMLSALRQQHALELSAAQSQIRALQTAVFEAEARAHTLQKHA
GALEDQLARGAATGNGTAPRAPVPVGGKAAKEGPPSRPSSRSRNHSDDLRRASLARQASG
GAPPPLASQTLLFGQNLSPETRHKRKVSLSMLKARIDSEVAAAAGASHLSSRAVSPAPVG
TGGGVGVAPGLPTVVEPRAPATLSLSLKHPQFLDESHIFWCHSCRGELVIL
Download sequence
Identical sequences jgi|Hetan1|153628|estExt_fgenesh2_pm.C_10199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]