SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|154205|estExt_fgenesh2_pm.C_20111 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|154205|estExt_fgenesh2_pm.C_20111
Domain Number 1 Region: 91-477
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.47e-59
Family AAT-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|154205|estExt_fgenesh2_pm.C_20111
Sequence length 504
Sequence
MSGTPSANPSRSTTPFHFRDVVLDVIKHFKHEKDSEAHQIFRSSAGHNPKAVLPQTINPD
EETVPGIQHPGSTGVIYCSDRAMANGFNYASSHEWANLGQGAPEVGPIPGATERPTKVEY
SLDALEYAPTTGVKALRDAVANLYNHTYRQGKASQYTYENVCIVPGGRAGLSRVAAVIGD
VYCSYQVPDYTAYDQVLSAFRRLVPVPTALEHENMYRLDIQQTKKDIRTQGLAVLIASNP
RNPTGQVIEGKDLKELVALSREDTTTLILDEFYSWYIYHDSEKDLGKSVSSAEYIEDVNT
DSVVIIDGLTKNWRLPGWRVCWVVGPKNLVTALSQSGSFLDGGANHPLQLAAIPLLDPEH
VQKEKIALQRHFKEKRDHVLKRLHELRLDVDVPPVSTFYIWLNLEKLPPPLNNGLTFFEE
LLKEKTIVIPGIFFDINPAHRRNLFSSPCHHFVRLSFGPPIEDLDKGLDAIGRVLRKARK
EGMRSFGHSYKKSIESIASLDDHV
Download sequence
Identical sequences W4KM79
jgi|Hetan1|154205|estExt_fgenesh2_pm.C_20111 XP_009542939.1.39223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]