SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|155104|estExt_fgenesh2_pm.C_40026 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|155104|estExt_fgenesh2_pm.C_40026
Domain Number 1 Region: 10-58,107-404,453-558
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.21e-69
Family AAT-like 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|155104|estExt_fgenesh2_pm.C_40026
Sequence length 560
Sequence
MDAEKTHDAVDLSHHLSDLAKARKMSPLKGLQKYMGREHMIAFAGGLPSPDYFPFAAVGG
DALVADSFALAPPPPPSPSPSPSPLAWLWRLLGSAPRAERTARIAVPKAPRAGDGGLNLA
TALQYGPATGMPALQAFVQAFSARVFRPAHAGFATLVHTGNTDGWSRCVMTLCNPGDTII
AEEWTYPSALASAGPVGVGVLPVAMDGEGMRADSLRELLEGWDVSRGRRPHVMYTVPVGQ
NPCGATMQLARKKQIYDICVEFDVVIVEDDPYFFLQVDEYVPKADRKAAPEASAQDEVSH
FIDSLAPSYLRVDYQGRVIRLDTFSKTIAPGVRLGWFTCNPMFAERLERQGETSTQSPCG
LGQALVTKLLSTWKYEGYIRWLRGLRMQYQLRRDLFVDLLAEEFELVQAPGTRAQGAWHG
RAVYTAYPKAPAPARGRALLSFGEKAGGGAVRKPLFSFVPPAAGMFVWVKLHFAGLARRR
GGGDEDDGEETTQEMRLWTALAEAGVLTAPGWFFAADQEDAPTDPDVEGHMRMSFSSAEP
EDMRKGVAIFAKTLKEFFRE
Download sequence
Identical sequences W4KCK5
jgi|Hetan1|155104|estExt_fgenesh2_pm.C_40026 XP_009543380.1.39223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]