SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|34492|estExt_Genewise1.C_40802 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|34492|estExt_Genewise1.C_40802
Domain Number 1 Region: 747-876,908-1108
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-60
Family p120GAP domain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 82-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.67e-39
Family Calponin-homology domain, CH-domain 0.00000811
Further Details:      
 
Domain Number 3 Region: 1340-1440
Classification Level Classification E-value
Superfamily RGC domain-like 3.01e-25
Family RGC domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|34492|estExt_Genewise1.C_40802
Sequence length 1441
Sequence
MEEDRRDRHSTRAQRILKREGELSTPERPQAQELIIPGVTNADEVAGIPGRLRLSRDRAP
SNPDSPLPSARLGRGSWADVQRHLLQAYEYLCHVGEAQQWIEGCLGEELGFGVVEMEEGL
RNGVVLAKLVRVYQGDGVVRRIYEAPKLDFRHSDNINYFSEFVRQVGLPESFIFELTDLY
EKKNFPKVIYCIHALSHLLARRGMAERIGNLLGRLQFSDDQLRKTQKGLKDAGVPMPNFG
NVGKELAKEINEEPEVEIETEDERRDRLLLENESSITATQSLARAFLIRKTHATQHRRQD
RMDLAPWTVALQATARRVLARQHLFARLQQILSHSYIFVQVQAQTRGYLVRHRIAKLKSA
VRTSSISVLKLQSLARAKIVRQQQKKLMRVFASDDVTTGIVGFQATARGVLLRRSIAKRL
NELDRLEVAIISLQAHVQGVLVRRRVHAQLSKLEDVSQTVIRIQAAVRTFLARKRLLTLI
RGLRKATPIVVHLQARARANLARQQHISVNKTLSKIEIVSSVGGFQALARAALARNRHRE
QNKQLEFAAPDIVGFQAVARGALVRLEYRAWRNHLWNNQGVAIFLQALLRGNLCRRKFRA
KMQYYRSHLDKVVKIQSLFRAKETREQYRQLTLGTNVTVGTIKNFVHLLDDSETDFQEEV
DLERMRKLVVERIRENQALESDVNDLDMKIALVVQNVKSFEELIKARRRYGADSAAAHAA
RASVLAAHGDPFAGPNTLDHAAKRKLELYQQLFYLLQSKGEYLGKLFVKVSLDGVPEKSR
RMLERVVLTLFGYGQDRREDYLLLKLFQFAINEEIANAKSIEDIVHNHPMYINIAVHYIR
PKQTTHVRESLQNIIRELIDAEELDLEVDPTRIYKSKIDLEEMRSGIASTKIKDVTFREA
LDDPIIRPEYIRHLQVLQWWTEAFLVAVTQSIKKMPYGIRFLAREMLHALQSKFPKATED
TCATCIGRLVYYRYINPAIIAPETFGIVTSTVDISSRKNLDQISKVLTQVTTGVEFGDDN
PSYIPINDFVQKAIKQVTQWLLEVADVPDAETQYHAHEFLDVTVQPKPIYISPNEVYAMH
TLLAQHIDFLAPGRDDTLRVIIHELDGVPHIGDDELKDARDQAITLDLTNRFAHVNDPRA
EEKTLWIQAKRAVLAILRVQPGKDLVESLMQPVTDEHELIWEEVLETEMAADHQLKHPRR
MPSTVAQESGYRLEDIRSLSFREVKAHAIFFLLELEKQGKITREDGYQGILNAIANDVRS
KHRMRLQRQKEIDSMKEALLNLSQRKKEFEEQINSYNNYVETAMATMQRGKGKKRFVMPF
TKQYFHLRDLQRSGKSPQFGSFKYSAQVLYDKGVLLSIDQFSPRQFDKIDLVLSSNQVGI
FTIEVFNHTLGITNRVASADIRMEDLLQAQFQDRASLSLFNGLAKFNLNLLLYQINKKFY
V
Download sequence
Identical sequences jgi|Hetan1|34492|estExt_Genewise1.C_40802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]