SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|34769|estExt_Genewise1.C_41239 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|34769|estExt_Genewise1.C_41239
Domain Number 1 Region: 169-576
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.29e-105
Family GABA-aminotransferase-like 0.00000000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|34769|estExt_Genewise1.C_41239
Sequence length 694
Sequence
MDKLSSLARFKASCPYLGRTKSSTLRTLCTSSSPRFPTLSKLTEKATQCPVMGPALAMRS
GQMVAGYASVAGNVDVNKIHKDKGVRIDSDNIAMCPHASKALAAAKMAQELTAAKNRTDA
LKADKAASQPSTSRAASPAPAGCPFHTAQATQAPSTEAKPAPVHSGAFNYERFYDAELQK
KHEDKSYRYFNNINRLAAKFPVAHTADPKSEVEVWCANDYLGMGNNPIVLETMHRTLDKY
GHGAGGTRNIAGNASWHLNLEKEIAALHRKPAALVFSSCYVANDATLATLGSKLPGCVYF
SDSSNHASMIQGIRHSGAKKVIWKHNDLQDLEAKLKEWPQDTPKIIAFESVYSMCGSVGP
IKEICDLAEKYGAITFLDEVHAVGLYGPRGAGVAEHIDYDAHKAAGQSPDPIPGTVMDRI
DIITGTLGKAFGAVGGYIAGSARFVDMIRSYAPGFIFTTSLPPVTIAGAHASIVYQKEFN
GDRQLMQWNVREVKKRFAERGIPVVPGPSHIVPVLIGDAGQAKEASDYLLQRHNIYVQAI
NFPTVARGEERLRFTITPGHTLEQLEHVVEAVNDTFSVLGIKREADWTAIGGRCGVGMEA
KETVVPVWNNEQLGLTGPDAATPKTRRQGEPKQVSMRAVRIARSKFDHLLGSLEPQPASV
SLGAMSGLKMRTGAGAVRRSENTIPAARPVAATA
Download sequence
Identical sequences W4KGY6
XP_009543976.1.39223 jgi|Hetan1|34769|estExt_Genewise1.C_41239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]