SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|64837|estExt_Genewise1Plus.C_70345 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|64837|estExt_Genewise1Plus.C_70345
Domain Number 1 Region: 95-209,303-593
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.13e-58
Family Pyridoxal-dependent decarboxylase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|64837|estExt_Genewise1Plus.C_70345
Sequence length 1077
Sequence
MLRWLPRLSDLVGTLSTSRSTVSETSPPGSLRDAHHAAGAWFLGPKAENAEYLQKFVGII
LQDLTKCRKDFSPEDKDFIDPAMVSSQAFKDSMSKLETNVTFLSSLLPQHSIPFYSPRYM
AHMLNDVSMPATLGYLMALMYNPNNVAVEGSPLTSIIEYDVGQQLCSMLGFNVAAPNQDP
RLSATGWGHITCDGSVANMESIKTRLYETSLTLLLARNLKYYPLSLKRAVESEPSLAFIS
HHFNIHLCSGKEKSLAECDAWDLLNLTPEEVVSLPGRIASQFCLSVQSLQGLMGKYIIQT
TGKDDLDAYFGLQRPPQYLASKTIHYSWPKGAAMTGIGSKNLIGVPVDQSARMDCEALDA
LLAQYLHNRQAVYCVVAIMGTTEHGTVDPISKIVALRSKYQKRGLSFLIHADAAWGGYFT
SVLVPNPTSHGGESSLDDPALFLHPYTKNELHHIRYADSVTIDPHKSGYVPYPAGSLCYR
DGRLRYLVTWTSPVIDSPEDGAQKMGVYGIEGSKPGAAPVAAWLGHEVIGLHKDGYGFLL
GEAVYTGIKMYGHWATMSLDHPTLLMVPFRMLPSEMKPNCTAKDIDDERRYIRDVILART
RQELAADPHARALMQQLGSDLVVNAFACNFRVNGKINKDVSEANLLNARIYERLSFHKLT
DKLNDRKVILMSTVFSQKEYGSCLTNYKKRLGLAGDGDLFALVNVSMSPFASPLNFEKVL
ADAFRETAEEEVKISIERNKSAPSLHAFIVQGSTNVYLVHMPCFSSASQRRQCILTGELS
ETGRQKYLHARTADPSATFIASTLQADELSSIVRRKSVEVLISKLTPSGHISIIKNRPLN
SRYLDQSYPTSMPFYLYGNSEEIHLDHMLLHAPNAQISANNVAVELDGMELGILASDLRN
GLIAIADTLPEHLLQPFTAEHRPNFFRPGFKVGITIYHDRSTSSAPGPGLVESLSSPLAR
GAITLGDSIFIESNLINVGTPLVASHVPKRNSFLPSSAESTTQDHPYFRGFGLERHMDAV
LSRPNKNAWRQGWDIALAQRQFAKMDIESPIEYTIEEKLTKEYCQSPVTVRASFSLS
Download sequence
Identical sequences jgi|Hetan1|64837|estExt_Genewise1Plus.C_70345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]