SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hetan1|68211|estExt_Genewise1Plus.C_140577 from Heterobasidion annosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hetan1|68211|estExt_Genewise1Plus.C_140577
Domain Number 1 Region: 136-567
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.75e-49
Family Cystathionine synthase-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Hetan1|68211|estExt_Genewise1Plus.C_140577
Sequence length 623
Sequence
MGNSHSQNRAANSRERPRTLKHHRSAPLLLQKSFINSTSTGSFSSTQSQEIYIRPTSEKA
ALVATEVLLPPPAPPVYVSPPSPGIFPALSVPDQIPEKGEAAAYSAFLRAYPEYHLTWTL
DALRKSEFSRVDTPHARETYVDYMGGALYPASLVNVHAEFLKGCVLGNTHSASNSSQLSA
NLTAQARAAVLAFFNAPPGSTVVFTANASAALKLVGECFPFSEGSTYVLPEDAHNSVHGI
RQFAKRRGAEVCYISATPQGGVEEPVVKRILQQHRPSKAPCLFALTGLSNISNSKPSLSL
LTYASALGYTTLLDAAALAATSPLDLTATPADAVAISFYKMFGFPTGVGALILAPGVGQR
LGGERPWFAGGTVEVVQVPGELVTRAEEIEEQFEDGTINYLLLPAITTGLRFLSAYLPFL
PLRLSSLTHHLTIELAKMRHLSTGQPAVRVLSRVPEKRLRAVGDKADAGSVVSVLFLDPN
GVQLPNSFISHASANAHISLRTGCMCNPGGAAALLRAKPAMTRLRAGATLAALESAAGRE
LGVVRISLGLASDWADIWRVLEFVRDFVLDARGREEAMGAWEASEGRLKGSPCATGACTP
NGVDQVRDVRAVRGPPSEVGRAF
Download sequence
Identical sequences W4JNJ3
XP_009553088.1.39223 jgi|Hetan1|68211|estExt_Genewise1Plus.C_140577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]