SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|400754485|ref|YP_006562853.1| from Phaeobacter gallaeciensis 2.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|400754485|ref|YP_006562853.1|
Domain Number 1 Region: 27-378
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.7e-109
Family IF2B-like 0.000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|400754485|ref|YP_006562853.1|
Sequence length 393
Comment methylthioribose-1-phosphate isomerase MtnA [Phaeobacter gallaeciensis 2.10]
Sequence
MIALYRQCARTTSNGGAGLAINGGPHVKINGTHYRSLWWDEDQSVLMIIDQRWLPHEFRI
QPVATLDEFATAIVEMRVRGAPLIGATAAYGMALATDLDPSDNALKAAWEQLNATRPTAI
NLRWALNRCMETLIPLPEEDRAKAALKLAHAIADEDVEINRRIGTYGLTLIRDIAAKKPA
GEPVRLLTHCNAGWIATVDWGTATSPMYQAHDAGIPIHVWVDETRPRNQGALTAWELGSH
GISHSYITDNAGGHLMQHGQVDLVITGTDRTTRQGDVCNKIGTYLKALAAHDNGVPFYVA
LPSPTIDWTVTDGVAEIPIEDRDSREVSHVQGVLDSGDMGLARVTPESTACGNPAFDVTP
NRLVTGLITERGICDASAEGLAALFPDLIRKAG
Download sequence
Identical sequences I7ECP8
gi|400754485|ref|YP_006562853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]