SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|40298|estExt_Genewise1Plus.C_200162 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Rhoba1_1|40298|estExt_Genewise1Plus.C_200162
Domain Number - Region: 7-78
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0706
Family DmpA-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|40298|estExt_Genewise1Plus.C_200162
Sequence length 339
Sequence
MSDLAATKKQRTAQVLCTHAGTFHCDDALAHALLRQLPRFADAELRRSRDPAVWDQSDIV
FDVSGEYDPPRGRFDHHQRGFNEVFGHGFTTKLSSAGLIYKHYGQEIVSTILGEPVESPV
VQQLWLKMYGDFVEALDGIDNGVAQYVTTEPPRYRSRTDLSSRVGALNPRWNEPSTDDVL
LDGFNKATELTGSEFLARLDYLHKAWLPARDIVVRAVEARKDVHPSGKVIVFTEFCPWKE
HLHVLEEELSIPKDELPLYVLYPESEKPDAKWRIQAVAVSPESFDSRKALPEAWRGVRDD
ALSTLTGIPGCVFVHAAGFIGGNVTKEGAMEMAIKALDL
Download sequence
Identical sequences A0A0P9IQJ6
jgi|Rhoba1_1|40298|estExt_Genewise1Plus.C_200162 XP_018267760.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]