SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|66806|estExt_fgenesh1_kg.C_120007 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|66806|estExt_fgenesh1_kg.C_120007
Domain Number 1 Region: 89-154
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.31e-27
Family Cyanase C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 11-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000795
Family Cyanase N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|66806|estExt_fgenesh1_kg.C_120007
Sequence length 163
Sequence
MSVVQSLAPAHQSLFEAKAVKGLSFEQIAQKVGRDEVWVAALFYGQAKPTEDEVKKLGKA
LGLQEGPLLKHWHPHYFPERGGLIPTGQAPADPTLYRLYEIISVYGYAIKSVIHERFGDG
IMSAINFSCKVDKVQKNGADNVQITLTGKWLPYDFHEEEQSAQ
Download sequence
Identical sequences A0A0P9EMG7
XP_018269025.1.32311 jgi|Rhoba1_1|66806|estExt_fgenesh1_kg.C_120007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]