SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Rhoba1_1|51222|estExt_Genemark1.C_2_t10093 from Rhodotorula graminis WP1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Rhoba1_1|51222|estExt_Genemark1.C_2_t10093
Domain Number 1 Region: 749-961
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000105
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 2 Region: 1111-1291
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000209
Family Tropomyosin 0.0068
Further Details:      
 
Weak hits

Sequence:  jgi|Rhoba1_1|51222|estExt_Genemark1.C_2_t10093
Domain Number - Region: 1003-1094
Classification Level Classification E-value
Superfamily Tropomyosin 0.00366
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 234-317
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0532
Family Spectrin repeat 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Rhoba1_1|51222|estExt_Genemark1.C_2_t10093
Sequence length 1676
Sequence
MDDSGASLCRFTDLSLRKFQAQKKATQGGAAASADTTHPSSPSTRTDATSVPASPASSIA
SVLSRAPPTLARSPAPPPAPLPNRQLASPPFPRPELAAPTPRQPAPASATARLFSPPPTL
STSPAPAPAPTIAPAAPPPARAHPQVHVPAPMQAAADYFSRILSPPPARSQPLKAQQQQQ
RQVEPEGRSGTPSSSARTSSTGVLVSPEPPSSPSYGASSTSSVRPQPQQPQEPQHDASQL
ASRVRELEALLADAPDPRELEGLRARVDECEGLLAEAPDPREVEGLRVRVDECEDECEEL
RARSRGDVERIANLERGVSIARAALAERRDELDARDAEIDDLVERLARFEEQDLPAQVAQ
RDARIADLERELDEARAQPPLAPAPEPEPAPAPEPAHDEAAAAELDALRVSLDAAESRAE
ALEQALVALRAETSGSAEAFRSRCEELEGLLSRAEQRAEDSGRERDALGEEKRTGEELRE
RLSGERDEALRDAREVKEALEERVRAGEADARRAEEAMRERDEARRELETAQAAARAASH
TAAGDDQDAAVGAEQLQAADASQPAAAAIVVERLEARIGELEREVEAHLSSIDELQGRFQ
PAADLEQLVVRLRADLDERARAVLQLELRVKDGEESLASATAELAQRDETLRSLEAQVAQ
AGDERADAVEQLEAAVKERDAAVERLESEVERLASDVETHLATIAALEAQVNGVAVGAEA
AARAEERVAALEADVAAHLATISFLESDAAARAAAASSLESSLESSLATAQSDLATAQAD
LDSSRTTVTSLETSLADLRSSTATHTERAAELDRMIEQLEGDKAALDGELDAARAQLAAA
EKERDEARAAADGERERAEALQGAVEESKEALAAAQAEAGSLRDEIESVRAELVAAEDRA
AAAERDLVTAKEKAVEAEEQMSSLKNELEQAQRVKKEAADAAKNDIDQLRADVARLQAAV
DENPSARGRGRLRKQLEARPVPVVAAAADPSASSRPSTPVNATRLNSLERDLGVFKNVLA
ASESRATALQHSLEAAEKELDDKEVELSRLEGELAASHAKERELEYSIETVTSKAAQSAS
VAADLQDRLDELKAGAASGSRSGDGADTPALTEELADVRRDLARTHGEAQQAVQARTLVE
ADLVKVKARVDTLENELRDKTGELASAQGRATTLDQQLSTSRADVERLTSAHDALQTTNA
DLTTTLDELRTQLSGLTSSSSSSTEQTLALTTSLAQLQSSESALRAELDSLRADLADAER
TKREVEDELALCRGEVEETSATLSAAMAELDATKDEVTELERAVEQGRDKLLSEGEAKAK
LEADAARLEDEVKALQARVAEAGESSTALETELASLRATLEDKEGLVARLEADAVEHADT
AKSDERESNELEALRQELELEREQLGEAKQSLHELRALYAEARDEVDALRSTSPGARSPS
QPVPPPDVDDLRLQLSDAQARIRQLEQDIFALESTRVKMLKANGDLKGQVESMMAALDEE
RTKARTKELELAAVRARPARSPSRAGPSTPPSAANVPLPATPTRTPSRTHAHRRTASILP
SVDELSDPTADTAVASNGRQPSSLAPLVSPPLVPVGRQHVRQASLSLLKARMEDEYGVPD
LDAAGPLVSPGAAPGAGRGGGAGAGAGPGARAKVVRAPLTHDLVWCHCCSGDLLVV
Download sequence
Identical sequences A0A194SD78
XP_018273400.1.32311 jgi|Rhoba1_1|51222|estExt_Genemark1.C_2_t10093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]