SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MCYG_01074T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MCYG_01074T0
Domain Number 1 Region: 119-365
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 8.34e-74
Family Glutamine synthetase catalytic domain 0.005
Further Details:      
 
Domain Number 2 Region: 30-116
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.15e-20
Family Glutamine synthetase, N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MCYG_01074T0
Sequence length 414
Sequence
MVGGPFASATPFANTRRSDAANLQKYMGLDQRGKVLAEYVWVDAHGGVRSKTKTLSRPVT
SPDELPEWNFDGSSTGQAPGHDSDVYLRPCAIFPDPFRGGDNILVLCETWDADGSPNKYN
YRHEAARLMRTHEKEQFWFGLEQEYTLLDADGWPFGWPKGGYPGAQGPYYCGVGTGKAQC
RDIVDAHYKACLYAGINISGINAEVMPSQWEYQVGPCEGIVLGDQLWMSRFLLNRVAEDF
GVVISFAPKPIPGDWNGAGLHSNVSTASMRAEGGMKVIEAAMKKLEARHPEHIAVYGEGN
EDRLTGRHETGSIDKFSWGVADRGGSIRIPRQCAKDGKGYFEDRRPASNADPYQITGIIV
ETVCHPPCLFQTHGTNLLSSSAVAIKPNDAPTSKCFSCFSSLFRCSRPTRLMPF
Download sequence
Identical sequences C5FEF2
MCYG_01074T0 XP_002850970.1.42340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]