SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MCYG_01876T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MCYG_01876T0
Domain Number - Region: 17-48
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0837
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MCYG_01876T0
Sequence length 1412
Sequence
MGVPKFFRWLSERYPAISQLIAENRIPEFDCLYLDMNGIIHNCTHKDSDSPAFRMTEDKM
FIAIFNYIEHLFGKIKPKRLFFMAIDGVAPRAKMNQQRARRFRTALDAELAKEKAIREGV
EMPKEDAFDSNCITPGTEFMTKLTKQLRYFINKKVSEDAEWQGVEVVLSGHEVPGEGEHK
IMEYIRQAKAQPEYDPNMRHCFTISLCSRESDVWTAEPEEIKELEHQNFYLLHLCIVREY
LELEFQELKLDGALQFPFDMERVIDDFILMAFFVGNDFLPNLPNLHINEGALAWMFKVYK
EVLPKLGGYVNEHGKINMERLRTLLAALSDVEFRFFEAEYSDARWLKSKTLGGDQTPTLP
DKPNVLTVTPAQKHIFNRIKKYVTHRPMDESGHPVPLDLSPSLPAKDRKFVEQLADSLHL
KWSSVLDNHDERFLRLQLPVNSDDDDDDDDDDGESQIAILRVLKKYENAKVQETTAEDAQ
LTAEKKYEKKFQEWKDKYYKEKFGWGLENTEEMRKLTENYVQGLQWVLFYYYRGVASWPW
FYRYHYAPMISDIHLGLGADVEFKLGQPFFPFQQLMGVLPDRSKKIVPVAYHSLMTTPES
PIIDFYPRDFELDMNGKKMEWEAVVKIPFIDEERLLKAMATKEHLLTPDEKARNTFGVTL
KFTYSPDVEFIYPSSLPGIFPDVSRCHCIENVFELPTMEGLDPYVGLVEGVKIGAEALAG
FPSLQTLQQTGQLGFHGVCVFQQESRNESMVVTIVDPEIAGNTTDAKAKLGRRVHVGYPF
LQEAKVVCVSDELFDYVQVDDEEHVVAIPHTPTQINQWKKKAEKIESYYSKRLGMIIGEV
ETIVRVEMLKGLMKTADGATVKEFTEIPGVETEYAAQLIVDSVISEDLRFIERAAVPIEE
EFPEGARAFFLGEYNYGAPVHVTGHEDGKLSGLLSAVKGKEPEFGREHVMNAEKLSKYTP
SFAIARNLHLSPLTLAKITSSFSVNVDGTRVNLGLNLKFEAKKLKVLGYSRRGNSGWEFS
ERAIGLLQDYMIKFPDFIAGIQRKPQGDLFEPTDFYPADIAKQKIKEIQSWLKSIESKSF
ERVPLEAEQLDSSIVQAIEKSADELHQTRAAPVAQKIRGVPRNALLKPADAEHRLNNQHF
QLGDRVIYAQDSGKVPIASRGTVVGLTRTSRNLLLDVLFDVSFMSGTTLSDRCSPFRGST
VPSSSVLNLTNRQLVALSRATAQNKEHAREQQPSKGAKYGAPQGSGGMGQLKDASTPPPL
TNSYRGAAIGQPSNSKVNGTPNLNWRGRGRGTLPIRNHPAHADTTGQPRPLFNRGRGNFN
QTNAHTGNGPSGRGRGRGGYVNVESMNTDSGVLNHNPDFKPRPYNTVPPPASLNQPTGQR
GSAGRARGRGMARGGRGRARAGHAGARGTTTA
Download sequence
Identical sequences C5FI77
MCYG_01876T0 XP_002848942.1.42340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]