SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MCYG_07468T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MCYG_07468T0
Domain Number 1 Region: 138-444
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.12e-56
Family Glutamine synthetase catalytic domain 0.001
Further Details:      
 
Weak hits

Sequence:  MCYG_07468T0
Domain Number - Region: 35-125
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0667
Family Glutamine synthetase, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MCYG_07468T0
Sequence length 456
Sequence
MAPHANKPKTGIESNSTASTEGSTALHALLNQYPSICFLRCQWQDYSGVVRARIVPIAQA
LSIAAEKRKLHVPGCAFHLTVNHENIPELNPRGYHWLVPDWDSLFPLAQQLNVNPSYATV
MCSVAEHLPVQPELNWNYCPRKALKTVVEKAEKLLQVHLLVGFEVEFQIMKASADGKLEP
HSSGMGRCAISGLRDPCVAHIQEVVQMLIGAGIGVGAFQTEGDRGQYEIALEPQSPLRAI
DELILVHDTLKSVFARHGLVATMAPRPVASHKQMAGQHTHISLNPPNKEASFLAGMLRRL
PGLCAFFLPYDLSYERVQPYLAGHIVAWGSENRAVAIRQIKTGHWELRCVDATANMYVAL
AAVISAGTIGCINEEELVWPDTGFITEHFPTSGTEPLPKSLTASLEQLNKSCDSLEEMIG
SRMLRHYIAVKRFEAPRLQRLPEETAVSKHTSVVYT
Download sequence
Identical sequences C5FYQ1
XP_002843685.1.42340 MCYG_07468T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]