SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MCYG_00551T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MCYG_00551T0
Domain Number 1 Region: 63-435
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.35e-101
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MCYG_00551T0
Sequence length 447
Sequence
MPILRLVRPAQGALLRASRLPVSRVRWASSVSQPPGSDHVRFPGAVNSKFTSDMSFVTPA
ANPAIPTYRVMDSEGVIVDKSRGPPDVTDEEVITWYKNMLCVSIMDMIMFEAQRQGRLSF
YMVSAGEEGIAVGSAAALSKDDVVFCQYRETGVFQQRGFTLKQFMSQLFANRNDSGKGRN
MPVHYGGKDVKTYTISSTLATQIPHASGAAYALKMKALQDPNAEKQVVACYFGEGAASEG
DFHAALNIAATRSCPVIFICRNNGYAISTPTLEQYRGDGIASRGIGYGIDTIRVDGNDIF
AVREATLEARKRALEGSMRPILIEAMSYRISHHSTSDDSFAYRARVEVEDWKRRDNPISR
LRKWMENKGIWNEDLDRETREQLRKDVLAEFAAAEREKKPALKEIFTDVFEELTPEVQKQ
REELKRIIEKYPKEYDVSEFEGGLKGL
Download sequence
Identical sequences C5FCX9
XP_002850447.1.42340 MCYG_00551T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]