SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MCYG_04702T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MCYG_04702T0
Domain Number 1 Region: 26-154,229-349,525-584
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.15e-38
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 359-526
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.66e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MCYG_04702T0
Sequence length 588
Sequence
MGMQSTPRPALSILRGLYANPARRTISTTNAPASFDDETDILVVGSGAAGLTAALRAQSH
GLRALVLEKNEAIGGTAAYSGGAMWIPNSYLSQAAGVKDSKEDAFQYLEATIGDVGPVSS
KERKVAFLDNGPRLVQFLQKAGFQWRLGKGGCPDYYPELPGSSMFGRTLEPDIFDMGKLG
SWKALVRKRPGPPIAAFVTESNSALKMGASFKDFTTLLNIVLRQGLRTLLGQSPVAMGQS
LIGQLLYLNKQADTPIQRNSALVGLIMDSSTVIGATVEQEGRRRTIRASRGVLLAAGGFS
HNKELREKWGPSPASVEWTSAPPGDTGDAITAAMKVGAATALLDDAWWGPTIICPVLGTP
IFALTERARPFSVIVDSSGSRFMNEAEPYTDAGHHQYKRHQNVKAIPAWLVVDSSFRKRY
NLGNLFPIQPDPKDGLKAGYLYKADTIQDLARQIDVDVQGLEKTLHRFNGMARAGVDEDF
RRGVSAFDNYFGDSKIGPNPNLGAIEKPPFYAVRIVPGDLGTKGGLLTDEHARVLRDSDG
KPIDRLYAAGNTSASIMGRTYSGAGATISPAMTFSFIAIDHMASSNSA
Download sequence
Identical sequences C5FP30
MCYG_04702T0 XP_002846965.1.42340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]