SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MCYG_07559T0 from Microsporum canis CBS 113480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MCYG_07559T0
Domain Number 1 Region: 48-312,411-480
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.76e-79
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000434
Further Details:      
 
Domain Number 2 Region: 503-647
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.14e-49
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 289-407
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.14e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MCYG_07559T0
Sequence length 647
Sequence
MSFSGLRSIAPTRQLTRVLRDQRRCFSQTRTAARIVASQPLRAKEASPFVSQKYPVIDHE
FDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHKDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGRIYQRAFGGQSQDYG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNANYFIEYFAMDLLMEDGECKGIIAYNQED
GTLHRFRAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSKGERFMENYAPTAKDLASRDVVSRSMTMEIREGRGVGPDK
DHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKEPIPVLPTVHYNMGGIPTKYTGEV
LTLDENGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTVRDNASPGAP
HKEISADAGAESIAALDKIRTANGSKSTFEIRNAMQKTMQTDVSVFRTQESLDEGVAKIT
EVDKTFDDVCIKDRSMIWNSDLVETMELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDTNWMKHTLTFQKQPHGKVDLTYRAVTGTTLDEAECKAVPPFKRTY
Download sequence
Identical sequences C5FYZ2
XP_002843776.1.42340 MCYG_07559T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]