SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PFDG_03628T0 from Plasmodium falciparum Dd2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFDG_03628T0
Domain Number 1 Region: 30-418,513-567
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.83e-95
Family SepSecS-like 0.000000484
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFDG_03628T0
Sequence length 578
Comment | PFDG_03628 | Plasmodium falciparum (isolate Dd2) hypothetical protein (579 aa)
Sequence
MNETLCDNNKAPKGGMKTSKKYSLISNQTLNQKENTIWNIVNNGRLPNYGLNEISVMNIL
YQISSQNLCNSEKNVKIGERENRIYSSIVRSKYIGFGHGIGRSGNLDDVQPKSAGNSILA
KLTSSFVKDLIRNFGIKSCEDVYILPYATGMCLSTCLLYLKQIREDSQYVIISRIDHKTC
YKCISFCNLKYFVVDMIYKNEELYTDLEGIEKLLEEYKEKICCVMSATSVYAPRNSDDII
KIAHICKKYNTPHIINNAFGLQCTYICKEIQKCFESQGRVDFVVQSCDKNFLVPVNGGII
FSSNREQMKLLKKSYPGRTPVNAYLDLFITLLEMGKDKIMNLRKERVDNFNWLKEKIQLL
CLKYNLELIKTSKNFISMAINLNHMYTHCNTDNPKVINMLGSMLFYRNVTGHRVICSPLL
NRNYLLKKAREKYMNMLENKKGNDAMMITSNESNEENVKRDLSKKEADIYDNMYSNGFDE
IKSVENDMLQNKSNIIKAYDKQIEEEFDKLNEPNTIVIGNHKFKNFGSSYNSYPISYIAF
SCVVGIERPELENFVSKLDNAIDYFIKFFKKKKEEELK
Download sequence
Identical sequences A0A0L7M7H6
PFDG_03628T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]