SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sepmu1|126372|fgenesh1_kg.6_#_282_#_isotig02629 from Septoria musiva v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sepmu1|126372|fgenesh1_kg.6_#_282_#_isotig02629
Domain Number 1 Region: 57-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000000732
Family LysM domain 0.0063
Further Details:      
 
Weak hits

Sequence:  jgi|Sepmu1|126372|fgenesh1_kg.6_#_282_#_isotig02629
Domain Number - Region: 144-185
Classification Level Classification E-value
Superfamily LysM domain 0.0379
Family LysM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sepmu1|126372|fgenesh1_kg.6_#_282_#_isotig02629
Sequence length 187
Sequence
MRCSLLTLSALATSAVCSVLPAAYSGTLEARVDNSNCTQYCSVSAGCVCTVRPSDCSEFY
TVQSGDTCLSIAKSFSSFTVTQFYKWNPNVGQTCFGLQAYVPVCINTPWYTFTPPVQPDF
GTHYTPDQTPVPIMPNIVSTCQEFELIEPGKRVEDLAAENGFEVNQFAEWNGNSTTAWAA
YWACVKA
Download sequence
Identical sequences N1QJN9
XP_016760141.1.6424 jgi|Sepmu1|126372|fgenesh1_kg.6_#_282_#_isotig02629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]