SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sepmu1|147862|estExt_fgenesh1_kg.C_3_t10039 from Septoria musiva v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sepmu1|147862|estExt_fgenesh1_kg.C_3_t10039
Domain Number 1 Region: 125-374
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 6.34e-71
Family Glutamine synthetase catalytic domain 0.0049
Further Details:      
 
Domain Number 2 Region: 17-122
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 7.72e-16
Family Glutamine synthetase, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sepmu1|147862|estExt_fgenesh1_kg.C_3_t10039
Sequence length 398
Sequence
MADSKIISNTATLEKYNKLTQHDKVIAEYVWIDASGGVRSKCATFDKKKDMKNWDWSKAP
IDQSEEAIKSLKEWNFDGSSTAQAPGDNSDVYLRPVAAFADPFRGGDNILVLAETWMSDG
KPNAFNFRHDAAVVMKAHEKHEFWFGLEQEYTLLDFEGWPYGWPKGGFPAPQGPYYCGVG
TGKVFCRDIVEAHYKACLYAGINISGTNAEVMPAQWEYQVGPCTGIDLGDQLWMSRFMLH
RVAEDFGAKITFAPKPIPGDWNGAGLHTNVSTKAMREDGGMKHIEAAMEKLATRHKEHMK
VYGEGNEARMTGAHETASYDKFTWGIANRGSSVRVNRACAEEGKGYFEDRRPASNGDPYQ
ITGLIVETICGKVEGADVFKTASQQPNEVDTVVPISKP
Download sequence
Identical sequences M3D809
jgi|Sepmu1|147862|estExt_fgenesh1_kg.C_3_t10039 XP_016762120.1.6424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]