SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sepmu1|152091|estExt_fgenesh1_kg.C_120133 from Septoria musiva v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sepmu1|152091|estExt_fgenesh1_kg.C_120133
Domain Number 1 Region: 10-328
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.25e-62
Family beta-Lactamase/D-ala carboxypeptidase 0.000000333
Further Details:      
 
Domain Number 2 Region: 438-536
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 9.68e-40
Family D-aminopeptidase, middle and C-terminal domains 0.0000984
Further Details:      
 
Domain Number 3 Region: 356-429
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0000256
Family D-aminopeptidase, middle and C-terminal domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sepmu1|152091|estExt_fgenesh1_kg.C_120133
Sequence length 537
Sequence
MTAPDNSPDRLLESLQDLLRGPGGAIAIIKNGETFLRHTYGFADLGRRIPLTPQMHMPIC
SISKHMFCLVLASLKSEPTPLMTKSVGDIWDQASAELQKVLPHLVTQGLTFADLYNMQSG
IRDYWAMTTLWGAHPEGPFSILLDAPQTVARTKSFHFQPGTEWSYSNVNFHILGQIIEAV
AGQSLGQLLDERVFKPAGMKSAALCPNTYGHPLPVVGYEGDEKHGYTPAVNRIEWAGDAG
IVASLDDMIAYEKWLERTYAEAGSLYSTIVAPQTYRDGTAAGYGFGLAHGETAGAAWTSH
GGALRGFRLHRIHVPEEHLSVVVLFNHEADSAAPADAIIKRLLQWQEPEKALSTPAPEWQ
GNFLDTETQLLVHVENIEDGQVSITYHMATEKVPLTSAIHAESKSIIANIAGDELHVERQ
REHRTLNARRIKSPTTTNSTNEYIGDYQCAEVDSSFHCSPGSGNLLYGSFDGFLGQGPAH
LMQYIGEDVWTLSNPRGMDAPAPGNWTIVFQRDENGKISGVTIGCWLARLIQFAKVL
Download sequence
Identical sequences M3ASF3
jgi|Sepmu1|152091|estExt_fgenesh1_kg.C_120133 XP_016756540.1.6424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]