SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sepmu1|131404|estExt_Genemark1.C_2_t20369 from Septoria musiva v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sepmu1|131404|estExt_Genemark1.C_2_t20369
Domain Number 1 Region: 140-467
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.12e-78
Family IF2B-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sepmu1|131404|estExt_Genemark1.C_2_t20369
Sequence length 474
Sequence
MSDPAAAAAAAPAVAAPAAAVTPAELKKRAKAEKQARRAAEKEAKGISAGGPQTAQQQQQ
QSQSQHGGQKAERQDRQVSVQQAPAQGQLPACATCAAQSALQEAAAAAEKEKKAESKNVE
LCSHLYAHPRRQNVDGASKDVLPVILALGFQFSSYEITGSTARCVAMLNAFKEAIQQYTT
PKGTSLARHMTAHHLSPQIEYLKSCRPLSESMGNSIRWLKKLIVEVDPSTPEQEAKDHLC
ASIDNFIQERIEVTDQAIATTASQQIEDGAVVLTYAKSSIVEKTILLAHASGVKFSVVCI
DSRPLYEGKKLATSLMQAGLKVEYTAFHGLANAMTHASVVLLGAHSMLSNGRLQSRIGTA
AVAMTAHQLDVPVVVCCESVKFSGKVALDSIASNEVAPAEELLPPPITSTIHGVDDEETK
SKTLDDWKEIPNLQILNLMYDTTPADFIDMVICEYGSVPPSSVPVVHRLANEGE
Download sequence
Identical sequences M3B7E2
XP_016763908.1.6424 jgi|Sepmu1|131404|estExt_Genemark1.C_2_t20369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]