SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sepmu1|152114|estExt_fgenesh1_kg.C_120159 from Septoria musiva v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sepmu1|152114|estExt_fgenesh1_kg.C_120159
Domain Number 1 Region: 20-111,201-439
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.51e-65
Family IF2B-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sepmu1|152114|estExt_fgenesh1_kg.C_120159
Sequence length 447
Sequence
MPSALLKWGHPPSLATFLKSHQELSVDSAIEHLEMLLKGRLIKNSRPCAIATTHLLLHVV
SSGEWDDSQSLIKRIREVGRRLIAARPREMAVGNIVRRVLSLVREVAETGNEQNGPVDDG
IVPGFSAQHHDSNTPESPSMSGSIEQLPPLQRPQMPSTAGSLFNIFGQPEGSLSKSSPMG
SGAATPAHGGQTQGKIEEIDLRAEVCAGIDDLLEELDIVDSQIAESALDHVHNNEIILTH
TSSSTVQRFLYAAAKGSLGVKGRKFTVIHAEAYPNDHAATHTTIVSGASKPGPEDRRWKA
LTELGITVILIPDTAVFALMSRVNKVILAPHTVLTNGSLIATAGASTIALAAKTHRVPVV
VLSGVYKLSPTYPFKPAHLIEYGDPGQVLEWQSDGEFMDAVDVVNPLYDHVAADLVDLYI
TNLGPHAPSFLYRIVADHYRAEDIDLS
Download sequence
Identical sequences M3CWG0
jgi|Sepmu1|152114|estExt_fgenesh1_kg.C_120159 XP_016756583.1.6424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]