SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sepmu1|80244|estExt_Genewise1.C_2_t40003 from Septoria musiva v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sepmu1|80244|estExt_Genewise1.C_2_t40003
Domain Number 1 Region: 76-143
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000129
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 2 Region: 405-476
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000956
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sepmu1|80244|estExt_Genewise1.C_2_t40003
Sequence length 507
Sequence
MDKYTRQAGDSAYDSDAEADDEFERSVFTSPTLCTTYDDQSDHPSDSEDDHSVLDGDDTP
TTQGWADREGRSPTGKITQWTEEEVADYVAALSPALKQYGQRFVEEGVNGEALIALGHDE
LRELGIVSVGHRLTILKAVYEQKMRAGVKIEEGDYIPLSAEGEKGEMTATQDDIARIIES
LRQRDLRIQSAEMELKGMRDYLDRISDENRKLREETLPIMRLVKDQRTPLPDPSGGTIPS
PRETDPTNRLMEQIQNKGSSLSRKFSTKKLFLNKDGPRQNSPTHGTTPQGREIRDDGGSH
LEASAAAMAASSHLTASMASQTSPNSVHGHQLSPTSPAYSTHVPPNNDASYVNNHYSQAS
TLAEEPPRSARQQQDRSRRQAPTPSPRDEATPEPGKDRDNPQVEIFKSFRVSIEDPCRVV
LPVALKRYNITDDWRQYALYIVHGDQERCLGLEEKPLLLFKQLDKEGRKPMFMLRRHASP
QEGWSNTSGVGAPAHAQEPKQVPGGVL
Download sequence
Identical sequences M3CNY0
XP_016763604.1.6424 jgi|Sepmu1|80244|estExt_Genewise1.C_2_t40003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]