SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70728327|ref|YP_258076.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70728327|ref|YP_258076.1|
Domain Number 1 Region: 2-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.98e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70728327|ref|YP_258076.1|
Sequence length 320
Comment thioredoxin-disulfide reductase [Pseudomonas protegens Pf-5]
Sequence
MSEVRHSRVIILGSGPAGYSAAVYAARANLKPLLITGMQAGGQLTTTTEVDNWPGDVHGL
TGPALMERMREHAERFETEIVFDHINAVDFAAKPYTLTGDSATYTCDALIIATGASARYL
GLPSEEAFMGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALYLANIASTVTLIHRRET
FRAEKILIDKLNARVAEGKIILKLNANLDEVLGDNMGVTGARLKNNDGSFDELKVDGVFI
AIGHTPNTSLFEGQLTLKDGYLVVQGGRDGNATATSVEGIFAAGDVADHVYRQAITSAGA
GCMAALDTERYLDGLQNASF
Download sequence
Identical sequences A0A1K1XWN9 A0A2K2WVX5 Q4KI57
WP_011059299.1.100210 WP_011059299.1.101844 WP_011059299.1.11424 WP_011059299.1.12653 WP_011059299.1.14038 WP_011059299.1.1721 WP_011059299.1.18072 WP_011059299.1.21308 WP_011059299.1.23266 WP_011059299.1.38500 WP_011059299.1.39301 WP_011059299.1.41899 WP_011059299.1.42452 WP_011059299.1.42693 WP_011059299.1.462 WP_011059299.1.46426 WP_011059299.1.48506 WP_011059299.1.49818 WP_011059299.1.58641 WP_011059299.1.62026 WP_011059299.1.6225 WP_011059299.1.64508 WP_011059299.1.6649 WP_011059299.1.67749 WP_011059299.1.76969 WP_011059299.1.79484 WP_011059299.1.81001 WP_011059299.1.81277 WP_011059299.1.83211 WP_011059299.1.88821 220664.PFL_0945 gi|70728327|ref|YP_258076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]