SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70729110|ref|YP_258846.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70729110|ref|YP_258846.1|
Domain Number 1 Region: 1-344
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000146
Further Details:      
 
Domain Number 2 Region: 349-473
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.23e-42
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70729110|ref|YP_258846.1|
Sequence length 478
Comment dihydrolipoamide dehydrogenase [Pseudomonas protegens Pf-5]
Sequence
MTQKFDVVVIGAGPGGYVAAIKAAQLGFTTACIEKYTDKEGKLALGGTCLNVGCIPSKAL
LDSSWKFHEAQDGFAIHGINHAGVTMDVPAMVGRKANIVKGLTSGVATLFKANGVTSIQG
HGKLLAGKKVEVTKPDGSVEVIEAENVILAPGSRPIDIPPAPVDQNVIVDSTGALEFQSV
PKRLGVIGAGVIGLELGSVWSRLGAQVTVLEALDTFLMAADTAVSKEALKTLTKQGLDIK
LGARVTGSKVNGEEVVVTYTDANGEQTITFDKLIVAVGRRPVTTDLLAADCGVTLDERGF
VHVDDHCATTVPGVYAIGDVVRGMMLAHKASEEGIMVAERIKGHKAQMNYDLIPSVIYTH
PEIAWVGKTEQALKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI
GPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGTAIHIANRKKR
Download sequence
Identical sequences A0A1K1Z8H0 A0A2C9EIR1 A0A2K4LVM1 Q4KFY7
220664.PFL_1720 gi|70729110|ref|YP_258846.1| gi|501679224|ref|YP_007999050.1| WP_011060054.1.100210 WP_011060054.1.101844 WP_011060054.1.11424 WP_011060054.1.12653 WP_011060054.1.14038 WP_011060054.1.1721 WP_011060054.1.18072 WP_011060054.1.21308 WP_011060054.1.23266 WP_011060054.1.27351 WP_011060054.1.38500 WP_011060054.1.39301 WP_011060054.1.41899 WP_011060054.1.42452 WP_011060054.1.42693 WP_011060054.1.462 WP_011060054.1.46426 WP_011060054.1.48506 WP_011060054.1.49818 WP_011060054.1.58641 WP_011060054.1.62026 WP_011060054.1.6225 WP_011060054.1.64508 WP_011060054.1.6649 WP_011060054.1.67749 WP_011060054.1.76749 WP_011060054.1.79484 WP_011060054.1.81001 WP_011060054.1.81277 WP_011060054.1.83211 WP_011060054.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]