SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70729899|ref|YP_259638.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70729899|ref|YP_259638.1|
Domain Number 1 Region: 4-335
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.34e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000279
Further Details:      
 
Domain Number 2 Region: 343-462
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.92e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70729899|ref|YP_259638.1|
Sequence length 463
Comment dihydrolipoamide dehydrogenase [Pseudomonas protegens Pf-5]
Sequence
MQQTLNTQLLIIGGGPGGYVAAIRAGQLGISTILVEGQSLGGTCLNIGCIPSKALIHVAE
QFHQTRHHSQGSALGIEVAAPTLNIGKSVEWKDGIVDRLTTGVAALLKKNKVQVIQGWAR
VIDGKTVEIEGADTRIQCEHLLLATGSKSVNLPMLPIGGPIISSTEALAPKTLPKRLTVV
GGGYIGLELGIAYRKLGVEVSVVEAQERILPAYDGELTQPVLDSVKQLGIKLYLKHSVLG
FDAASSSLQVREPNGDTLNLATDQVLVAVGRKPNTQGWNLESLNLDMNGAAIKIDHRCQT
SMRNVWAIGDLSGEPMLAHRAMAQGEMVAELIAGKHREFNPAAIPAVCFTDPELVVVGKT
PDEARAAGLDCIVSSFPFAANGRAMTLESKNGFVRVVARSDNHLIVGWQAVGVGVSELST
AFGQSLEMGARLEDIGGTIHAHPTLGEAVQEAALRALGHALHL
Download sequence
Identical sequences Q4KDP5
220664.PFL_2531 WP_011060827.1.14038 WP_011060827.1.18072 WP_011060827.1.42693 gi|70729899|ref|YP_259638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]