SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70730758|ref|YP_260499.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70730758|ref|YP_260499.1|
Domain Number 1 Region: 199-513
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.8e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000981
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.35e-30
Family PDI-like 0.0000646
Further Details:      
 
Domain Number 3 Region: 104-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.59e-21
Family PDI-like 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70730758|ref|YP_260499.1|
Sequence length 521
Comment alkyl hydroperoxide reductase [Pseudomonas protegens Pf-5]
Sequence
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLKDIVSLSNQITLLDNGSDAR
KPSFSLNRPGSDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERKVMAVPSVYLNGVNF
GQGRMGLEEILAKLDTGAVEKQAQKLNAKEAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQATEGPKLAAALEEHVKQYDVDIMNLQRASALVPAKEVGG
LHEIQFESGASLKAKSVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLFSLPNVKVITSALTSEVKGDG
QKVTGLAYKDRDSGEFHTVDLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
Download sequence
Identical sequences A0A2C9ENF7 A0A2K2WUB8 Q4KB84
220664.PFL_3394 gi|501680872|ref|YP_008000698.1| WP_011061676.1.100210 WP_011061676.1.11424 WP_011061676.1.12653 WP_011061676.1.14038 WP_011061676.1.1721 WP_011061676.1.18072 WP_011061676.1.21308 WP_011061676.1.27351 WP_011061676.1.41899 WP_011061676.1.42452 WP_011061676.1.42693 WP_011061676.1.462 WP_011061676.1.6225 WP_011061676.1.67749 WP_011061676.1.76749 gi|70730758|ref|YP_260499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]