SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70731240|ref|YP_260981.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70731240|ref|YP_260981.1|
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.05e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70731240|ref|YP_260981.1|
Sequence length 316
Comment thioredoxin-disulfide reductase [Pseudomonas protegens Pf-5]
Sequence
MNDAKHSRLIILGSGPAGYSAAVYAARANLKPTVITGLQAGGQLTTTTEVDNWPGDVEGL
TGPVLMERMQRHAERFDTEIVYDHIHTAQLQQRPFILIGDSGTYSCDALIIATGASAQYL
GLPSEEAFAGKGVSACATCDGFFYRNQVVAVVGGGNTAVEEALYLSNIAKEVHLVHRRDK
LRAEKILQDKLFDKAANGNIRLHWNQHLEEVLGDASGVTGARLKDSHSGETKDLPLAGVF
IAIGHKPNTDLFQGQLEMRDGYLLVRGGSEGNATATGIQGVFAAGDVADHVYRQAITSAG
AGCMAALDAEKFLDDN
Download sequence
Identical sequences A0A2K2WI50 Q4K9V2
gi|70731240|ref|YP_260981.1| 220664.PFL_3881 WP_011062169.1.11424 WP_011062169.1.14038 WP_011062169.1.1721 WP_011062169.1.18072 WP_011062169.1.21308 WP_011062169.1.39301 WP_011062169.1.41899 WP_011062169.1.42693 WP_011062169.1.462 WP_011062169.1.46426 WP_011062169.1.6225 WP_011062169.1.64508 WP_011062169.1.67749 WP_011062169.1.81001 WP_011062169.1.81277 WP_011062169.1.83211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]