SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70731328|ref|YP_261069.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70731328|ref|YP_261069.1|
Domain Number 1 Region: 4-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.09e-110
Family FMN-linked oxidoreductases 0.00000000237
Further Details:      
 
Domain Number 2 Region: 336-524
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000098
Further Details:      
 
Domain Number 3 Region: 465-523,561-657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-21
Family C-terminal domain of adrenodoxin reductase-like 0.000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70731328|ref|YP_261069.1|
Sequence length 679
Comment 2,4-dienoyl-CoA reductase [Pseudomonas protegens Pf-5]
Sequence
MAGAPYPHLLAPLDLGFTTLRNRTLMGSMHTGLEEKPGGFERMAAYFAERARGGVGLMVT
GGIGPNDEGGVYSGAAKLTTEEEALKHQIVTRAVHEAGGKICMQILHAGRYAYSPKQVAP
SAIQAPINPFKPKELDEEGIEKQIRDFVTCSTLAQKAEYDGVEIMGSEGYFINQFLAAHT
NHRTDRWGGSYENRMRLPVEIVRRVREAVGPNFIIIFRLSMLDLVEGGSTWEEIVQLAQA
IEQAGATLINTGIGWHEARIPTIATKVPRAAFSKVTAKLRGSVSIPLITTNRINTPEVAE
QILAEGDADMVSMARPFLADPDFVNKAAEGRADEINTCIGCNQACLDHTFGGKLTSCLVN
PRACHETELNYLPVKQIKKIAVVGAGPAGLSAATVAAERGHQVTLFDSASEIGGQFNIAK
RVPGKEEFFETLRYFKRKLQTSHVELCLNTRVDVQQLVAGGFDEIILATGIAPRVPAIPG
VEHAKVLSYLDVLLERKPVGKSVAVIGAGGIGFDVSEFLVHQGVATSQDRQAFWKEWGID
TQLQARGGVAGIKPEPHAPARQVFLLQRKKTKVGDGLGKTTGWIHRTGLKNKQVQMLNSV
EYLKIDDAGLHIRIGEAGEPQVLPVDNIVICAGQDPLRELQDGLVAAGQNVHLIGGADVA
AELDAKRAINQGSRLAAEL
Download sequence
Identical sequences A0A2C9EQ54 A0A2K2WNC7 Q4K9L4
gi|70731328|ref|YP_261069.1| 220664.PFL_3969 WP_011062256.1.11424 WP_011062256.1.14038 WP_011062256.1.1721 WP_011062256.1.18072 WP_011062256.1.21308 WP_011062256.1.27351 WP_011062256.1.41899 WP_011062256.1.42452 WP_011062256.1.42693 WP_011062256.1.462 WP_011062256.1.48506 WP_011062256.1.6225 WP_011062256.1.67749 WP_011062256.1.76749 gi|501681472|ref|YP_008001298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]