SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70733774|ref|YP_257414.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70733774|ref|YP_257414.1|
Domain Number 1 Region: 1-344
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.32e-63
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000217
Further Details:      
 
Domain Number 2 Region: 349-473
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.78e-41
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70733774|ref|YP_257414.1|
Sequence length 484
Comment dihydrolipoamide dehydrogenase [Pseudomonas protegens Pf-5]
Sequence
MSESYDVIVIGAGPGGYVAAIRAAQLGLKTVCIERYKGKDGKTALGGTCLNVGCIPSKAL
LDSSHHYYEARNGFEVHGIAISNPQMDVPAMLARKDNVVRNFNGGIASLFKANGVALLEG
HGKLLANKEVEVTAADGSTQRISAGNIILAPGSRPIDIPAAPLAGEVIVDSTGALEFTQV
PKRLGVIGAGVIGLELGSVWARLGAQVTVLEALDSFLPAVDAQIAKEAQKILGKQGLDIR
LGARVTACEVQGDSVKVSLSEAGEDKQQVFDRLIVAVGRRPLTTDLLAADSGVHLDERGF
IHVDGQCCTSVPGVFAIGDVVRGPMLAHKASEEGVMVAEGIAGHRHPLNYDLIPSVIYTH
PEIAWVGQTEQALKAEGVELNIGTFPFAASSRAMAANDTAGLVKVIADAGTDRVLGVHVI
GPGAAELVQEGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGQAIHIGNRKKKAP
AGVK
Download sequence
Identical sequences Q4KK19
gi|70733774|ref|YP_257414.1| 220664.PFL_0268 WP_011058648.1.14038 WP_011058648.1.18072 WP_011058648.1.42693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]