SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70730900|ref|YP_260641.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70730900|ref|YP_260641.1|
Domain Number 1 Region: 10-239
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.11e-45
Family Alanine racemase-like, N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 207-354
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.97e-28
Family Eukaryotic ODC-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70730900|ref|YP_260641.1|
Sequence length 365
Comment carboxynorspermidine decarboxylase [Pseudomonas protegens Pf-5]
Sequence
MIKTPYYLIDKQKLLSNMQKIAYVREQSGAKALLALKCFATWSVFDLMQQYMDGTTSSSL
YELKLGRQKFEGETHAYSVAWADDEIEEMLANCDKIIFNSISQLQRFADASAGKVRGLRV
NPQVSSSDYLLADPARPFSRLGEWDPAKIEQVIEQISGFMFHNNCENGDFGLFDQMLTTI
EERFGHLLHKVEWVSLGGGIHFTGEDYALDAFCARLKAFSQKYGVQVYLEPGEAAITQSA
SLEVTVLDTLYNGKHLAVVDSSIEAHMLDLLIYRLNAKLSPSAGEHTYMVCGKSCLAGDI
FGEYQFDRPLAIGDRLSFIDAAGYTMVKKNWFNGLKMPSIVVKQLDGSIEVVREFGFEDY
LSSLS
Download sequence
Identical sequences A0A2C9ENX9 A0A2K2WU09 Q4KAU2
gi|70730900|ref|YP_260641.1| 220664.PFL_3538 WP_011061817.1.100210 WP_011061817.1.11424 WP_011061817.1.12653 WP_011061817.1.14038 WP_011061817.1.1721 WP_011061817.1.18072 WP_011061817.1.21308 WP_011061817.1.27351 WP_011061817.1.39301 WP_011061817.1.41899 WP_011061817.1.42452 WP_011061817.1.42693 WP_011061817.1.462 WP_011061817.1.46426 WP_011061817.1.49818 WP_011061817.1.6225 WP_011061817.1.64508 WP_011061817.1.67749 WP_011061817.1.76749 WP_011061817.1.76969 WP_011061817.1.81001 WP_011061817.1.81277 WP_011061817.1.83211 WP_011061817.1.88821 NYSGRC-FDAO-AAY92805 gi|501681025|ref|YP_008000851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]