SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70733488|ref|YP_263263.1| from Pseudomonas protegens Pf-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70733488|ref|YP_263263.1|
Domain Number 1 Region: 427-568
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.83e-28
Family Flavohemoglobin, C-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 322-420
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.19e-28
Family Ferredoxin reductase FAD-binding domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 556-665
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.52e-20
Family 2Fe-2S ferredoxin-related 0.073
Further Details:      
 
Domain Number 4 Region: 159-276
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000164
Family PNP-oxidase like 0.013
Further Details:      
 
Weak hits

Sequence:  gi|70733488|ref|YP_263263.1|
Domain Number - Region: 33-125
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00533
Family PNP-oxidase like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70733488|ref|YP_263263.1|
Sequence length 679
Comment pyridoxamine 5'-phosphate oxidase family protein/oxidoreductase, FAD-binding and NAD-binding domains/2Fe-2S iron-sulfur cluster binding domain-containing protein [Pseudomonas protegens Pf-5]
Sequence
MSSSSPWHAGERQLQARAGVAERMEAFGTKVIRQAMPDQHRQFYGQLPFILVGAVDAQGN
PWTSILEGPPGFAQAPEATRLRLGSLPAADDPVQLQEGAALGLLGIELHTRRRNRFNGRV
SAVDRHGFSVTVQQAFGNCPQYIQQRELQQVALSDPASRPAQYRDGLDPEARALIGGADT
FFVASYVDLDGQRSVDVSHRGGQAGFVRVEGNCLTIPDFAGNLHFNTLGNLLLNPRAGLL
FIDFHSGELLQLSGRTEIIHDGPLVKAFQGAERLWRFTVERLVRRPAALSLRWQLQGFSP
NSLLTGSWPQAEARLRATALGQQWRPLRVTRIEDESSSIRSFYLEPADAAGAPSFVPGQH
LPVQVVLDGQPLIRTYSLSSAPSDDFLRISVKREGQVSRHLHQALKVGDLLQARAPQGRF
TADALSSQPLVLLAAGVGITPLLSMLREVLYQGLRTRHTRPTWLIQGSRTLAEQPFAKEL
QTLLAQAGDSVRLLRLLSQPEAGARPGAGFDHCGRIDVQLLLAQPDLDLDRADFVLCGPG
AFTQGLYDSLRDLDIDDRQIHAETFGPSTLRRRPDPEAVPFAQPPAATRAVAVRFQQAGR
ELSWEPASGSLLQLAESAGLHPPFSCRGGSCGTCQTRLISGQVNYPQVPAQLPEPGQVLI
CCAVPAAVDNLVPALVLDL
Download sequence
Identical sequences Q4K3C0
gi|70733488|ref|YP_263263.1| WP_011064370.1.14038 WP_011064370.1.18072 WP_011064370.1.42693 220664.PFL_6205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]