SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|148316|estExt_Genewise1Plus.C_14_t10389 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|148316|estExt_Genewise1Plus.C_14_t10389
Domain Number 1 Region: 22-160
Classification Level Classification E-value
Superfamily dUTPase-like 3.27e-44
Family dUTPase-like 0.00000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|148316|estExt_Genewise1Plus.C_14_t10389
Sequence length 193
Sequence
MPALQPPAPIAPSIAAGAAAEQQLQVQLLSEHAKAPTKGSAFAAGHDLYSAVDMVIPARG
RALVATDIKVSVPVGTYGRVAPRSGLAYKHGIDTLAGVIDADYRGPVGVILANLSDTDFP
VKIGDRIAQLVVEKIVMPDVVVVKELEESVRGAGGFGSTGGFGSVAAAAAAAAAVVVPET
AKDESKEEQGTKA
Download sequence
Identical sequences R0K757
jgi|Settu1|148316|estExt_Genewise1Plus.C_14_t10389 XP_008023490.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]