SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|151300|estExt_Genewise1Plus.C_210234 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|151300|estExt_Genewise1Plus.C_210234
Domain Number 1 Region: 82-299
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.75e-43
Family C-terminal domain of adrenodoxin reductase-like 0.00000674
Further Details:      
 
Domain Number 2 Region: 4-138,297-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000104
Family C-terminal domain of adrenodoxin reductase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 341-444
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000553
Family N-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|151300|estExt_Genewise1Plus.C_210234
Sequence length 449
Sequence
MNKNHDAIVDMYEQLPVPYGLVRYGVAPDHPEVKNCQDTFEEVAQSPRFNYIGNVRVGFD
VDLVKMKPHYDAMLFSYGASEDRQLGIPGEDLPGVYSARSFVGWYNGLPQFRDLRPNLHA
GEQAVVIGQGNVALDVARILLSPVDALRGTDIADQAIQALSESRVRSVRVVGRRGPIQAA
FTVKEARELMQIPSVAFEPIDRSLYPPDIKKLPRVQKRIAEVLLKGSKASLQDAPRSWAL
EFMQAPKAMHADGDHLSSITFTKQNFVPDGDPFDQKTRVVPTAEESTMEASLAFRSVGYK
STALPGLSDLGVPFDDRLGIIPNDMHGRVMTPSAGPGNLTAGHVPGLYCAGWVKRGPTGV
IASTMQDAFASAEIIAQDWEAGVPFLNDNRSTGLGWDAIKDAVESKGVRPLSWADWKKID
GAERERGRARGKEREKFQSVEEMLNVLDA
Download sequence
Identical sequences R0JZB7
XP_008026214.1.61199 jgi|Settu1|151300|estExt_Genewise1Plus.C_210234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]