SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|162767|fgenesh1_kg.1_#_782_#_isotig05553 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|162767|fgenesh1_kg.1_#_782_#_isotig05553
Domain Number 1 Region: 20-108,243-479
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.95e-70
Family IF2B-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|162767|fgenesh1_kg.1_#_782_#_isotig05553
Sequence length 486
Sequence
MQGATIQAPGLSTYLKSLKSTPVDASVEHFTALLKRRQIRNSRPCAIATTALLLRVVGEF
KGRDAAKLIERIKQVGRRLTSAQPREVVVGNIVRRVLGLVREVVEEHAEGQTPTGSEPGH
ATPHAHHKNDSLHRPALSSSISTFSPLRHAVAEPMSASGYADNASDASEPSRRPPLLTSH
TSYAPASSAPLVHSLFGLFSQPADTPSATSTPTGQASPVGKGSLTALNLERLAGMERSQN
LDLKGEVMEGIRELQDELETSDKQIAEVALEHIHANEIILTHTASTTVQKFLLFAARKRK
FTVVHAETYPHDHTATHGILLTGKKREANPGDDEEDDKWKPLTDAGIQVYVIPDSHVFAI
MSRVNKVILATHTVLANGGLVAAAGAHMIAMAAKEHQTPVVVLSGVYKLSPVYPFDIDEL
IEHGDAGGVVPFDDGEFVDKVDVANPLYDYVPADLVDLYITNLGGHAPSYLYRIVADHYR
SEDITL
Download sequence
Identical sequences R0J616
jgi|Settu1|162767|fgenesh1_kg.1_#_782_#_isotig05553 XP_008021186.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]