SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|163071|fgenesh1_kg.2_#_303_#_isotig03844 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|163071|fgenesh1_kg.2_#_303_#_isotig03844
Domain Number 1 Region: 459-817
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.65e-70
Family PFOR PP module 0.0000142
Further Details:      
 
Domain Number 2 Region: 1088-1293
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.1e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000016
Further Details:      
 
Domain Number 3 Region: 788-942
Classification Level Classification E-value
Superfamily Flavoproteins 2.33e-38
Family Cytochrome p450 reductase N-terminal domain-like 0.033
Further Details:      
 
Domain Number 4 Region: 1376-1507
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000128
Further Details:      
 
Domain Number 5 Region: 954-1087
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.42e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0013
Further Details:      
 
Domain Number 6 Region: 1295-1373
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.52e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.00075
Further Details:      
 
Domain Number 7 Region: 8-197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000224
Family PFOR Pyr module 0.00041
Further Details:      
 
Domain Number 8 Region: 346-448
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000113
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|163071|fgenesh1_kg.2_#_303_#_isotig03844
Sequence length 1529
Sequence
MGSISTAGEAVARIAHQASDVIVSVVPSLTTESEFSVPLQRLQKDNAPSVVCKTLPEVLT
ARQNADPLLSVFQPIRAGKLTSVTTTSSILVKSIPHLYKLAQYPVVLHVSVAPSGYPDFS
DITSIRQSGFAFIQSETLQELQDLALTAHALAIKSGKGVIHFFDSGASAFKKTVEVEDAQ
LIRSVLDMDAVAAYQNSQSQETTLYADDGRTSTLTFARSQAVNAASTTAPASVPDQSKLL
PVSERNSQRGDSSSGSSQREASTSGASLSSATTVESLVSKPVSSEDIYRFATQIWATIKD
ATGRSYDAFAFSGTGKEEAAIFLFGADTAVFATELDSVDETKAYANTAIITARLYRPWLG
ASLAPMLPSSLKRIAVLEQVRRKTTRWGPVLLDLLMSLKSTGGASPMVVGYQLGYINEET
VSQAMRGVFQNLMSESPVQNLVIGKIDGPEAKSAKVEQPALENAYMKILNQVFAEKLHIA
NQLGSQHAGISNEISASPEYGFGSLVARKEHRTRLIDQAAAASKDNSFTTQAPQQWLSKW
ALSANDADKANELASEVISRLATDGSPLANQLLSSKKLFYKESQWLIGSDAWAYDLGNSG
VHHVLASGENVNMLIIDSTPYSERSAADAARRKKDIGLYAMNFGNAYVASVAVYSSYTQV
LEAMIEADKFNGPSVVLAYLPYEKESDTPLTVLQETKKAVDLGYWPLYRWDPRGEEKGEA
NFKLDSERIKKELEEFLSRDNYMSQVMKRHPEFSSNLSGSYGTEVRQLQKRKAKDAYSKL
LEGLQGDPLTILFASDNGNAENLAKRLGNRGKARGLKTMVMAMDDFPLEDLPNEQNVVLM
TSVAGQGEFPQNGRAFWEAVKDSTDLDLATVNFGVFGLGDSHYWPRKEDKIYYNKPAKDL
HARLLTLGGKPLVDCGLGDDQDPDAYQTAYAEWEPKLWEKLGVANVENLPEEPAPLTNED
MKAASNFLRGTIEEGLADTSTGAISASDQQLTKFHGTYMQDDRDLRDQRKAQGLEPAYSF
MIRCRLPGGVSTPKQWLQMDEISTTLGNQTMKLTTRQTFQFHGVVKGKLKPAMQAINKAL
MTTIAACGDVNRNVMCSSLPTQSKYHGQVHSYAQKISDHLLPSTTAYHEIWLEDDETKQK
RKIAGEAIQDHEPLYGPLYLPRKFKITIAIPPHNDTDVYAHDIGLIAIKGEDGNLAGFNV
LAGGGMGVTHNNKKTYPRTGTMFGYVEADQVHLVCEKIMLVQRDHGDRKNRKHARLKYTI
DDMGVDVFIGKVEDLWGQKFAEPKPFKFQSNIDTFGWQKDELGLNHFTFFIENGRIEDTA
DFPMKTGLIEVAKAHKGEFRLTGNQHLILANVADEDLPAMKELLKKWKLDNTNFSGMRLS
SSACVAFPTCGLAMAESERYLPELITKLEGTLEEAGLRQDSIVMRMTGCPNGCARPWLAE
VAFVGKAYGAYNMYLGGGYHGQRLNKLYRSSIKEDEILEIMKPMIKQYAKERNEGEHFGD
FVIRKGIINETTHGQNFHDNTAEAESDAE
Download sequence
Identical sequences R0IQG9
jgi|Settu1|163071|fgenesh1_kg.2_#_303_#_isotig03844 XP_008025519.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]